PDB entry 4o4x

View 4o4x on RCSB PDB site
Description: Crystal structure of the vaccine antigen Transferrin Binding Protein B (TbpB) double mutant Tyr-167-Ala and Trp-176-Ala from Haemophilus parasuis Hp5
Class: metal transport
Keywords: Structure-based vaccine design, transferrin receptor, iron acquisition, host pathogen interaction, surface lipoprotein, METAL TRANSPORT
Deposited on 2013-12-19, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TbpB
    Species: Haemophilus parasuis [TaxId:738]
    Database cross-references and differences (RAF-indexed):
    • PDB 4O4X (Start-531)
    Domains in SCOPe 2.07: d4o4xa1, d4o4xa2, d4o4xa3, d4o4xa4
  • Chain 'B':
    Compound: TbpB
    Species: Haemophilus parasuis [TaxId:738]
    Database cross-references and differences (RAF-indexed):
    • PDB 4O4X (Start-531)
    Domains in SCOPe 2.07: d4o4xb1, d4o4xb2, d4o4xb3, d4o4xb4
  • Heterogens: GOL, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o4xA (A:)
    gsfdledvqpnkttgvskeeykdvetdkkvkeqlgelmepalgyvvkvpvsqsgvkrtei
    snpeaitdedlnkipnyeiikgvaypnygelvdktaaetmkyvrsgyvidvyhsgtrdkg
    yvfykgitpskelpqgpaltyqgewdftsdanlnneegrptalnddyyttaigkraglvs
    gdakpskhkytsqfkvdfatkkmtgklsdkektiytvnadirgnrftgsatasdkdkgkg
    asynffsvdsqsleggfygpkaeemagkfvaddkslfavfsakhnasnvntvriidaski
    dltnfsiseltnfgdasvliidgkkmelagseftnkhtidingkkmvavaccsnleymkf
    gqlwqqtegekqvkdnslflqgertatdkmpkdgnykyigtwdaqvskennywvataddd
    rkagyrtefdvdfgsknlsgklfdkngvnpvftvnakidgngftgeaktsdagfvldpgs
    lrhdnvkfsdvavsggfygptaaelggqfryqsdngsvgvgavfgakqqvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o4xA (A:)
    eykdvetdkkvkeqlgelmepalgyvvkvpvsqsgvkrteisnpeaitdedlnkipnyei
    ikgvaypnygelvdktaaetmkyvrsgyvidvyhsgtrdkgyvfykgitpskelpqgpal
    tyqgewdftsdanlnneegrptalnddyyttaigkraglvsgdakpskhkytsqfkvdfa
    tkkmtgklsdkektiytvnadirgnrftgsatasdkdkgkgasynffsvdsqsleggfyg
    pkaeemagkfvaddkslfavfsakhnasnvntvriidaskidltnfsiseltnfgdasvl
    iidgkkmelagseftnkhtidingkkmvavaccsnleymkfgqlwqqtekqvkdnslflq
    gertatdkmpkdgnykyigtwdaqvskennywvatadddrkagyrtefdvdfgsknlsgk
    lfdkngvnpvftvnakidgngftgeaktsdagfvlnvkfsdvavsggfygptaaelggqf
    ryqsdngsvgvgavfgakqqvkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o4xB (B:)
    gsfdledvqpnkttgvskeeykdvetdkkvkeqlgelmepalgyvvkvpvsqsgvkrtei
    snpeaitdedlnkipnyeiikgvaypnygelvdktaaetmkyvrsgyvidvyhsgtrdkg
    yvfykgitpskelpqgpaltyqgewdftsdanlnneegrptalnddyyttaigkraglvs
    gdakpskhkytsqfkvdfatkkmtgklsdkektiytvnadirgnrftgsatasdkdkgkg
    asynffsvdsqsleggfygpkaeemagkfvaddkslfavfsakhnasnvntvriidaski
    dltnfsiseltnfgdasvliidgkkmelagseftnkhtidingkkmvavaccsnleymkf
    gqlwqqtegekqvkdnslflqgertatdkmpkdgnykyigtwdaqvskennywvataddd
    rkagyrtefdvdfgsknlsgklfdkngvnpvftvnakidgngftgeaktsdagfvldpgs
    lrhdnvkfsdvavsggfygptaaelggqfryqsdngsvgvgavfgakqqvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o4xB (B:)
    eykdvetdkkvkeqlgelmepalgyvvkvpvsqsgvkrteisnpeaitdedlnkipnyei
    ikgvaypnygelvdktaaetmkyvrsgyvidvyhsgtrdkgyvfykgitpskelpqgpal
    tyqgewdftsdanlnneegrptalnddyyttaigkraglvsgdakpskhkytsqfkvdfa
    tkkmtgklsdkektiytvnadirgnrftgsatasdkdkgkgasynffsvdsqsleggfyg
    pkaeemagkfvaddkslfavfsakhnasnvntvriidaskidltnfsiseltnfgdasvl
    iidgkkmelagseftnkhtidingkkmvavaccsnleymkfgqlwqqtqvkdnslflqge
    rtatdkmpkdgnykyigtwdaqvskennywvatadddrkagyrtefdvdfgsknlsgklf
    dkngvnpvftvnakidgngftgeaktsdagfvldnvkfsdvavsggfygptaaelggqfr
    yqsdngsvgvgavfgakqqvkk