PDB entry 4o4u

View 4o4u on RCSB PDB site
Description: Crystal structure of the vaccine antigen Transferrin Binding Protein B (TbpB) mutant Trp-176-Ala from Haemophilus parasuis Hp5
Class: metal transport
Keywords: Structure-based vaccine design, transferrin receptor, iron acquisition, host pathogen interaction, surface lipoprotein, METAL TRANSPORT
Deposited on 2013-12-19, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TbpB
    Species: Haemophilus parasuis [TaxId:738]
    Database cross-references and differences (RAF-indexed):
    • PDB 4O4U (Start-531)
    Domains in SCOPe 2.07: d4o4ua1, d4o4ua2, d4o4ua3, d4o4ua4
  • Chain 'B':
    Compound: TbpB
    Species: Haemophilus parasuis [TaxId:738]
    Database cross-references and differences (RAF-indexed):
    • PDB 4O4U (Start-531)
    Domains in SCOPe 2.07: d4o4ub1, d4o4ub2, d4o4ub3, d4o4ub4
  • Chain 'C':
    Compound: TbpB
    Species: Haemophilus parasuis [TaxId:738]
    Database cross-references and differences (RAF-indexed):
    • PDB 4O4U
    Domains in SCOPe 2.07: d4o4uc1, d4o4uc2, d4o4uc3, d4o4uc4
  • Chain 'D':
    Compound: TbpB
    Species: Haemophilus parasuis [TaxId:738]
    Database cross-references and differences (RAF-indexed):
    • PDB 4O4U (Start-531)
    Domains in SCOPe 2.07: d4o4ud1, d4o4ud2, d4o4ud3, d4o4ud4
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o4uA (A:)
    gsfdledvqpnkttgvskeeykdvetdkkvkeqlgelmepalgyvvkvpvsqsgvkrtei
    snpeaitdedlnkipnyeiikgvaypnygelvdktaaetmkyvrsgyvidvyhsgtrdkg
    yvfykgitpskelpqgpaltyqgewdftsdanlnneegrptylnddyyttaigkraglvs
    gdakpskhkytsqfkvdfatkkmtgklsdkektiytvnadirgnrftgsatasdkdkgkg
    asynffsvdsqsleggfygpkaeemagkfvaddkslfavfsakhnasnvntvriidaski
    dltnfsiseltnfgdasvliidgkkmelagseftnkhtidingkkmvavaccsnleymkf
    gqlwqqtegekqvkdnslflqgertatdkmpkdgnykyigtwdaqvskennywvataddd
    rkagyrtefdvdfgsknlsgklfdkngvnpvftvnakidgngftgeaktsdagfvldpgs
    lrhdnvkfsdvavsggfygptaaelggqfryqsdngsvgvgavfgakqqvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o4uA (A:)
    eykdvetdkkvkeqlgelmepalgyvvkvpvsqsgvkrteisnpeaitdedlnkipnyei
    ikgvaypnygelvdktaaetmkyvrsgyvidvyhsgtrdkgyvfykgitpskelpqgpal
    tyqgewdftsdanlnneegrptylnddyyttaigkraglvsgdakpskhkytsqfkvdfa
    tkkmtgklsdkektiytvnadirgnrftgsatasdkdkgkgasynffsvdsqsleggfyg
    pkaeemagkfvaddkslfavfsakhnasnvntvriidaskidltnfsiseltnfgdasvl
    iidgkkmelagseftnkhtidikkmvavaccsnleymkfgqlwqqtqvkdnslflqgert
    atdkmpkdgnykyigtwdaqvskennywvatadddrkagyrtefdvdfgsknlsgklfdk
    ngvnpvftvnakidgngftgeaktsdagfvldpgrhdnvkfsdvavsggfygptaaelgg
    qfryqsdngsvgvgavfgakqqvkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o4uB (B:)
    gsfdledvqpnkttgvskeeykdvetdkkvkeqlgelmepalgyvvkvpvsqsgvkrtei
    snpeaitdedlnkipnyeiikgvaypnygelvdktaaetmkyvrsgyvidvyhsgtrdkg
    yvfykgitpskelpqgpaltyqgewdftsdanlnneegrptylnddyyttaigkraglvs
    gdakpskhkytsqfkvdfatkkmtgklsdkektiytvnadirgnrftgsatasdkdkgkg
    asynffsvdsqsleggfygpkaeemagkfvaddkslfavfsakhnasnvntvriidaski
    dltnfsiseltnfgdasvliidgkkmelagseftnkhtidingkkmvavaccsnleymkf
    gqlwqqtegekqvkdnslflqgertatdkmpkdgnykyigtwdaqvskennywvataddd
    rkagyrtefdvdfgsknlsgklfdkngvnpvftvnakidgngftgeaktsdagfvldpgs
    lrhdnvkfsdvavsggfygptaaelggqfryqsdngsvgvgavfgakqqvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o4uB (B:)
    eykdvetdkkvkeqlgelmepalgyvvkvpvsqsgvkrteisnpeaitdedlnkipnyei
    ikgvaypnygelvdktaaetmkyvrsgyvidvyhsgtrdkgyvfykgitpskelpqgpal
    tyqgewdftsdanlnneegrptylnddyyttaigkraglvsgdakpskhkytsqfkvdfa
    tkkmtgklsdkektiytvnadirgnrftgsatasdkdkgkgasynffsvdsqsleggfyg
    pkaeemagkfvaddkslfavfsakhnasnvntvriidaskidltnfsiseltnfgdasvl
    iidgkkmelagseftnkhtidikmvavaccsnleymkfgqlwqqqvkdnslflqgertat
    dkmpkdgnykyigtwdaqvskennywvatadddrkagyrtefdvdfgsknlsgklfdkng
    vnpvftvnakidgngftgeaktsdagfvldpdnvkfsdvavsggfygptaaelggqfryq
    sdngsvgvgavfgakqqvkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4o4uC (C:)
    gsfdledvqpnkttgvskeeykdvetdkkvkeqlgelmepalgyvvkvpvsqsgvkrtei
    snpeaitdedlnkipnyeiikgvaypnygelvdktaaetmkyvrsgyvidvyhsgtrdkg
    yvfykgitpskelpqgpaltyqgewdftsdanlnneegrptylnddyyttaigkraglvs
    gdakpskhkytsqfkvdfatkkmtgklsdkektiytvnadirgnrftgsatasdkdkgkg
    asynffsvdsqsleggfygpkaeemagkfvaddkslfavfsakhnasnvntvriidaski
    dltnfsiseltnfgdasvliidgkkmelagseftnkhtidingkkmvavaccsnleymkf
    gqlwqqtegekqvkdnslflqgertatdkmpkdgnykyigtwdaqvskennywvataddd
    rkagyrtefdvdfgsknlsgklfdkngvnpvftvnakidgngftgeaktsdagfvldpgs
    lrhdnvkfsdvavsggfygptaaelggqfryqsdngsvgvgavfgakqqvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o4uC (C:)
    ykdvetdkkvkeqlgelmepalgyvvkvpvsqsgvkrteisnpeaitdedlnkipnyeii
    kgvaypnygelvdktaaetmkyvrsgyvidvyhsgtrdkgyvfykgitpskelpqgpalt
    yqgewdftsdanlnneegrptylnddyyttaigkraglvsgdakpskhkytsqfkvdfat
    kkmtgklsdkektiytvnadirgnrftgsatasdkdkgkgasynffsvdsqsleggfygp
    kaeemagkfvaddkslfavfsakhnasnvntvriidaskidltnfsiseltnfgdasvli
    idgkkmelagseftnkhtidikmvavaccsnleymkfgqlwqqtqvkdnslflqgertat
    dkmpkdgnykyigtwdaqvskennywvatadddrkagyrtefdvdfgsknlsgklfdkng
    vnpvftvnakidgngftgeaktsdagfvldphdnvkfsdvavsggfygptaaelggqfry
    qsdngsvgvgavfgakqqv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4o4uD (D:)
    gsfdledvqpnkttgvskeeykdvetdkkvkeqlgelmepalgyvvkvpvsqsgvkrtei
    snpeaitdedlnkipnyeiikgvaypnygelvdktaaetmkyvrsgyvidvyhsgtrdkg
    yvfykgitpskelpqgpaltyqgewdftsdanlnneegrptylnddyyttaigkraglvs
    gdakpskhkytsqfkvdfatkkmtgklsdkektiytvnadirgnrftgsatasdkdkgkg
    asynffsvdsqsleggfygpkaeemagkfvaddkslfavfsakhnasnvntvriidaski
    dltnfsiseltnfgdasvliidgkkmelagseftnkhtidingkkmvavaccsnleymkf
    gqlwqqtegekqvkdnslflqgertatdkmpkdgnykyigtwdaqvskennywvataddd
    rkagyrtefdvdfgsknlsgklfdkngvnpvftvnakidgngftgeaktsdagfvldpgs
    lrhdnvkfsdvavsggfygptaaelggqfryqsdngsvgvgavfgakqqvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o4uD (D:)
    eykdvetdkkvkeqlgelmepalgyvvkvpvsqsgvkrteisnpeaitdedlnkipnyei
    ikgvaypnygelvdktaaetmkyvrsgyvidvyhsgtrdkgyvfykgitpskelpqgpal
    tyqgewdftsdanlnneegrptylnddyyttaigkraglvsgdakpskhkytsqfkvdfa
    tkkmtgklsdkektiytvnadirgnrftgsatasdkdkgkgasynffsvdsqsleggfyg
    pkaeemagkfvaddkslfavfsakhnasnvntvriidaskidltnfsiseltnfgdasvl
    iidgkkmelagseftnkhtidikkmvavaccsnleymkfgqlwqqtqvkdnslflqgert
    atdkmpkdgnykyigtwdaqvskennywvatadddrkagyrtefdvdfgsknlsgklfdk
    ngvnpvftvnakidgngftgeaktsdagfvldpgslrhdnvkfsdvavsggfygptaael
    ggqfryqsdngsvgvgavfgakqqvkk