PDB entry 4o4t

View 4o4t on RCSB PDB site
Description: MURINE NEUROGLOBIN UNDER XENON PRESSURE 30 bar
Class: oxygen storage/transport protein
Keywords: GLOBIN, OXYGEN STORAGE-TRANSPORT PROTEIN complex
Deposited on 2013-12-19, released 2014-09-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97
      • engineered mutation (57)
      • engineered mutation (122)
    Domains in SCOPe 2.04: d4o4ta_
  • Heterogens: HEM, SO4, XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o4tA (A:)
    gshmerpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedsls
    spefldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllyml
    ekslgpdftpatrtawsrlygavvqamsrgwdge
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o4tA (A:)
    rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
    dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
    pdftpatrtawsrlygavvqamsrgwdg