PDB entry 4o4q

View 4o4q on RCSB PDB site
Description: Crystal structure of the complex formed between type 1 ribosome inactivating protein and uridine diphosphate at 1.81 A resolution
Class: hydrolase
Keywords: Ribosome inactivating protein, Complex hydrolase, Ligand binding, Hydrolase, uridine diphosphate
Deposited on 2013-12-19, released 2014-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rRNA N-glycosidase
  Species: Momordica balsamina [TaxId:3672]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D9J2T9 (0-245)
  Domains in SCOPe 2.08: d4o4qa_
• Heterogens: GOL, NAG, UDP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4o4qA (A:)
  dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
  tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
  prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
  pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
  lntkni