PDB entry 4o49

View 4o49 on RCSB PDB site
Description: Crystal structure of the vaccine antigen Transferrin Binding Protein B (TbpB) mutant Tyr-174-Ala from Actinobacillus pleuropneumoniae H87
Class: metal transport
Keywords: Structure-based vaccine design, transferrin receptor, iron acquisition, host pathogen interaction, surface lipoprotein, METAL TRANSPORT
Deposited on 2013-12-18, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer membrane protein; transferrin-binding protein
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Gene: tfbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44167 (Start-522)
      • conflict (113)
      • engineered mutation (168)
    Domains in SCOPe 2.07: d4o49a1, d4o49a2, d4o49a3, d4o49a4
  • Heterogens: GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o49A (A:)
    gsfdlddvqpnkavepektkvnytdeetqkrkkeeldklmepalgyvtkipvnipsvrkt
    eiseidtvtdeslslvpnedklrtianenygsvvtksgsntmnfvrsgytidvvhyglrd
    kgyvyykgvhpskelpkgniivyqgewdftsnadldakrpnynpefngagagqrvgvtsa
    dakertyiskfnidfsnkklngqlltktkenqeklrytveanisgnrfrgkatatdktdp
    ilgkdsehlegglygpkseelagkfvahdkslfavfsgkrgndvletvkiidaskidltt
    fesselnnfgnanvliidgqkidlagadfknrktvdingktmvaiaccsnleymkfgqlw
    qkegeqtkdnslflqgertatdkipvggnykyvgtwdalvskgtnwvaeadnnresgyrs
    efdvnfgdkkvsgklfdkggivpvfminadikgngftgtanttdtgfaldsgssqhgnav
    fsdikvnggfygptagelggqfhhksdngsvgavfgakrqiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o49A (A:)
    vnytdeetqkrkkeeldklmepalgyvtkipvnipsvrkteiseidtvtdeslslvpned
    klrtianenygsvvtksgsntmnfvrsgytidvvhyglrdkgyvyykgvhpskelpkgni
    ivyqgewdftsnadldakrpnynpefngagagqrvgvtsadakertyiskfnidfsnkkl
    ngqlltktkenqeklrytveanisgnrfrgkatatdktdpilgkdsehlegglygpksee
    lagkfvahdkslfavfsgkrgndvletvkiidaskidlttfesselnnfgnanvliidgq
    kidlagadfknrktvdingktmvaiaccsnleymkfgqlwqkegeqtkdnslflqgerta
    tdkipvggnykyvgtwdalvskgtnwvaeadnnresgyrsefdvnfgdkkvsgklfdkgg
    ivpvfminadikgngftgtanttdtgfaldsqhgnavfsdikvnggfygptagelggqfh
    hksdngsvgavfgakrqiek