PDB entry 4o1y

View 4o1y on RCSB PDB site
Description: Crystal structure of Porcine Pancreatic Phospholipase A2 in complex with 1-Naphthaleneacetic acid
Class: hydrolase
Keywords: Hydrolase, 1-Naphthaleneacetic acid binding, PLA2, Pancreatic enzyme
Deposited on 2013-12-16, released 2014-01-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2, major isoenzyme
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00592 (0-123)
  Domains in SCOPe 2.03: d4o1ya_
• Heterogens: NLA, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4o1yA (A:)
  alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
  ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
  kkyc