PDB entry 4o1t

View 4o1t on RCSB PDB site
Description: Crystal structure of murine neuroglobin mutant F106W
Class: transport protein
Keywords: Globin, oxygen storage-transporter, TRANSPORT PROTEIN
Deposited on 2013-12-16, released 2014-06-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.171
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97
      • engineered mutation (57)
      • engineered mutation (108)
      • engineered mutation (122)
    Domains in SCOPe 2.04: d4o1ta_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o1tA (A:)
    gshmerpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedsls
    spefldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlsswstvgesllyml
    ekslgpdftpatrtawsrlygavvqamsrgwdge
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o1tA (A:)
    rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
    dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlsswstvgesllymlekslg
    pdftpatrtawsrlygavvqamsrgwdg