PDB entry 4o1r

View 4o1r on RCSB PDB site
Description: Crystal structure of NpuDnaB intein
Class: splicing
Keywords: splicing
Deposited on 2013-12-16, released 2014-03-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.162
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replicative DNA helicase
    Species: Nostoc punctiforme [TaxId:63737]
    Gene: Npun_F2831
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2IVH9 (2-100)
      • expression tag (0-1)
      • conflict (3)
      • conflict (96)
    • Uniprot B2IVH9 (103-141)
      • expression tag (101-102)
      • conflict (105)
      • conflict (114)
    Domains in SCOPe 2.05: d4o1ra_
  • Heterogens: NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4o1rA (A:)
sggalagdslvtlvdsglqvpikelvgksgfavwalneatmqlekaivsnafstgikplf
tlttrlgrkiratgnhkfltingwkrldeltpkehlalprnsgsdiywdeivsitysgee
evfdltvpglhnfvanniivhn