PDB entry 4o1q

View 4o1q on RCSB PDB site
Description: Crystal Structure of the Q103N-MauG/pre-Methylamine Dehydrogenase Complex
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2013-12-16, released 2014-04-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.201
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG, Pden_4736
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51658
      • engineered mutation (108)
  • Chain 'B':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG, Pden_4736
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51658
      • engineered mutation (108)
  • Chain 'C':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4733
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4o1qc_
  • Chain 'D':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4733
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4o1qe_
  • Chain 'F':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HEC, EDO, PO4, PGE, MES, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4o1qC (C:)
    hhhhhhadapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklat
    aswvascynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaed
    damtyhctispivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o1qC (C:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4o1qE (E:)
    hhhhhhadapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklat
    aswvascynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaed
    damtyhctispivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o1qE (E:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'F':
    No sequence available.