PDB entry 4o1q

View 4o1q on RCSB PDB site
Description: Crystal Structure of the Q103N-MauG/pre-Methylamine Dehydrogenase Complex
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2013-12-16, released 2014-04-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.201
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Methylamine utilization protein MauG
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauG, Pden_4736
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51658
    • engineered mutation (108)
• Chain 'B':
  Compound: Methylamine utilization protein MauG
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauG, Pden_4736
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51658
    • engineered mutation (108)
• Chain 'C':
  Compound: Methylamine dehydrogenase light chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: Pden_4733
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BBA0 (Start-136)
  Domains in SCOPe 2.08: d4o1qc_
• Chain 'D':
  Compound: Methylamine dehydrogenase heavy chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: Pden_4730
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BB97 (Start-384)
• Chain 'E':
  Compound: Methylamine dehydrogenase light chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: Pden_4733
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BBA0 (Start-136)
  Domains in SCOPe 2.08: d4o1qe_
• Chain 'F':
  Compound: Methylamine dehydrogenase heavy chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: Pden_4730
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BB97 (Start-384)
• Heterogens: CA, HEC, EDO, PO4, PGE, MES, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >4o1qC (C:)
  hhhhhhadapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklat
  aswvascynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaed
  damtyhctispivgkas
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4o1qC (C:)
  tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
  gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
  vgkas
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >4o1qE (E:)
  hhhhhhadapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklat
  aswvascynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaed
  damtyhctispivgkas
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4o1qE (E:)
  tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
  gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
  vgkas
  

  
  
• Chain 'F':
  No sequence available.