PDB entry 4o1m

View 4o1m on RCSB PDB site
Description: Toxoplasma gondii Enoyl acyl carrier protein reductase
Class: oxidoreductase
Keywords: Rossmann fold, oxidoreductase, Enoyl acyl carrier protein reductase
Deposited on 2013-12-16, released 2014-02-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier reductase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: Enoyl reductase, ENR, TGVEG_000410
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o1ma_
  • Chain 'B':
    Compound: enoyl-acyl carrier reductase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: Enoyl reductase, ENR, TGVEG_000410
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o1mb_
  • Chain 'C':
    Compound: enoyl-acyl carrier reductase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: Enoyl reductase, ENR, TGVEG_000410
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o1mc_
  • Chain 'D':
    Compound: enoyl-acyl carrier reductase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: Enoyl reductase, ENR, TGVEG_000410
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o1md_
  • Chain 'E':
    Compound: enoyl-acyl carrier reductase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: Enoyl reductase, ENR, TGVEG_000410
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o1me_
  • Chain 'F':
    Compound: enoyl-acyl carrier reductase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: Enoyl reductase, ENR, TGVEG_000410
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o1mf_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o1mA (A:)
    safpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrld
    edrklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgn
    idilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsyl
    aaervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigksge
    ksfidyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavd
    srsmpplqratqein
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o1mA (A:)
    pidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrldedr
    klpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgnidi
    lvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsylaae
    rvvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaisfidyaid
    ysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavdsrsmpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o1mB (B:)
    safpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrld
    edrklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgn
    idilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsyl
    aaervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigksge
    ksfidyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavd
    srsmpplqratqein
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o1mB (B:)
    pidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrldedr
    klpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgnidi
    lvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsylaae
    rvvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaifidyaidy
    synnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavdsrsmpp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4o1mC (C:)
    safpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrld
    edrklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgn
    idilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsyl
    aaervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigksge
    ksfidyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavd
    srsmpplqratqein
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o1mC (C:)
    fpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrlded
    rklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgnid
    ilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsylaa
    ervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasafidyaidy
    synnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavdsrsmppl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4o1mD (D:)
    safpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrld
    edrklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgn
    idilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsyl
    aaervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigksge
    ksfidyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavd
    srsmpplqratqein
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o1mD (D:)
    pidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrldedr
    klpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgnidi
    lvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsylaae
    rvvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaifidyaidy
    synnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavdsrsmpp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4o1mE (E:)
    safpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrld
    edrklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgn
    idilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsyl
    aaervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigksge
    ksfidyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavd
    srsmpplqratqein
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o1mE (E:)
    fpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrlded
    rklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgnid
    ilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsylaa
    ervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaisfidyai
    dysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavdsrsmpp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4o1mF (F:)
    safpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrld
    edrklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgn
    idilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsyl
    aaervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigksge
    ksfidyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavd
    srsmpplqratqein
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o1mF (F:)
    pidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrldedr
    klpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgnidi
    lvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsylaae
    rvvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaisfidyaid
    ysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavdsrsmppl