PDB entry 4o1l

View 4o1l on RCSB PDB site
Description: Human Adenosine Kinase in complex with inhibitor
Class: Transferase/Transferase inhibitor
Keywords: Adenosine Kinase, Transferase-Transferase inhibitor complex
Deposited on 2013-12-16, released 2014-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4o1la_
  • Chain 'B':
    Compound: adenosine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4o1lb_
  • Heterogens: MG, HO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o1lA (A:)
    apqalrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkve
    yhaggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqp
    tgtcaacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesv
    lkvahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetk
    dikeiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngag
    dafvggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o1lA (A:)
    lrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyhag
    gstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgtc
    aacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkva
    hhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdike
    iakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkidtngagdafvgg
    flsqlvsdkplteciraghyaasiii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o1lB (B:)
    apqalrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkve
    yhaggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqp
    tgtcaacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesv
    lkvahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetk
    dikeiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngag
    dafvggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o1lB (B:)
    apqalrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkve
    yhaggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqp
    tgtcaacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesv
    lkvahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetk
    dikeiakktqalpkmnskrqriviftqgrddtimatesevtafavlidtngagdafvggf
    lsqlvsdkplteciraghyaasiiirrtgctfpekpdfh