PDB entry 4o0s

View 4o0s on RCSB PDB site
Description: Crystal structures of human kinase Aurora A
Class: transferase
Keywords: Protein Kinase, TRANSFERASE
Deposited on 2013-12-14, released 2014-12-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4o0sa_
  • Heterogens: ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o0sA (A:)
    eskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrre
    veiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitela
    nalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemi
    egrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlis
    rllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o0sA (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrtlcgtldylppemiegrmh
    dekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkh
    npsqrpmlrevlehpwitansskps