PDB entry 4o0n

View 4o0n on RCSB PDB site
Description: 2.4 Angstrom Resolution Crystal Structure of Putative Nucleoside Diphosphate Kinase from Toxoplasma gondii.
Class: transferase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, 2-Layer Sandwich, Putative Nucleoside Diphosphate Kinase, TRANSFERASE
Deposited on 2013-12-13, released 2013-12-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.195
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_295350
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o0na_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_295350
    Database cross-references and differences (RAF-indexed):
    • Uniprot S8FF85 (Start-154)
      • expression tag (155)
    Domains in SCOPe 2.03: d4o0nb_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_295350
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o0nc_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_295350
    Database cross-references and differences (RAF-indexed):
    • Uniprot S8FF85 (Start-154)
      • expression tag (155)
    Domains in SCOPe 2.03: d4o0nd_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_295350
    Database cross-references and differences (RAF-indexed):
    • Uniprot S8FF85 (Start-154)
      • expression tag (155)
    Domains in SCOPe 2.03: d4o0ne_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_295350
    Database cross-references and differences (RAF-indexed):
    • Uniprot S8FF85 (Start-154)
      • expression tag (155)
    Domains in SCOPe 2.03: d4o0nf_
  • Chain 'G':
    Compound: Nucleoside diphosphate kinase
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_295350
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o0ng_
  • Chain 'H':
    Compound: Nucleoside diphosphate kinase
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_295350
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o0nh_
  • Chain 'I':
    Compound: Nucleoside diphosphate kinase
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_295350
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o0ni_
  • Chain 'J':
    Compound: Nucleoside diphosphate kinase
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_295350
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o0nj_
  • Chain 'K':
    Compound: Nucleoside diphosphate kinase
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_295350
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o0nk_
  • Chain 'L':
    Compound: Nucleoside diphosphate kinase
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_295350
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4o0nl_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o0nA (A:)
    maakqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgk
    pffpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivh
    gsdsvesankeislwftpeeicewtsaqhkwvyeqgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o0nA (A:)
    akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
    fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
    dsvesankeislwftpeeicewtsaqhkwvyeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o0nB (B:)
    maakqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgk
    pffpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivh
    gsdsvesankeislwftpeeicewtsaqhkwvyeqgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o0nB (B:)
    akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
    fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
    dsvesankeislwftpeeicewtsaqhkwvyeqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4o0nC (C:)
    maakqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgk
    pffpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivh
    gsdsvesankeislwftpeeicewtsaqhkwvyeqgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o0nC (C:)
    akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
    fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
    dsvesankeislwftpeeicewtsaqhkwvyeq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4o0nD (D:)
    maakqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgk
    pffpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivh
    gsdsvesankeislwftpeeicewtsaqhkwvyeqgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o0nD (D:)
    akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
    fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
    dsvesankeislwftpeeicewtsaqhkwvyeqg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4o0nE (E:)
    maakqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgk
    pffpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivh
    gsdsvesankeislwftpeeicewtsaqhkwvyeqgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o0nE (E:)
    akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
    fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
    dsvesankeislwftpeeicewtsaqhkwvyeqg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4o0nF (F:)
    maakqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgk
    pffpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivh
    gsdsvesankeislwftpeeicewtsaqhkwvyeqgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o0nF (F:)
    akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
    fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
    dsvesankeislwftpeeicewtsaqhkwvyeqg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4o0nG (G:)
    maakqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgk
    pffpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivh
    gsdsvesankeislwftpeeicewtsaqhkwvyeqgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o0nG (G:)
    kqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpff
    pglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgsd
    svesankeislwftpeeicewtsaqhkwvyeq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4o0nH (H:)
    maakqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgk
    pffpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivh
    gsdsvesankeislwftpeeicewtsaqhkwvyeqgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o0nH (H:)
    akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
    fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
    dsvesankeislwftpeeicewtsaqhkwvyeq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4o0nI (I:)
    maakqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgk
    pffpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivh
    gsdsvesankeislwftpeeicewtsaqhkwvyeqgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o0nI (I:)
    akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
    fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
    dsvesankeislwftpeeicewtsaqhkwvyeq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4o0nJ (J:)
    maakqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgk
    pffpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivh
    gsdsvesankeislwftpeeicewtsaqhkwvyeqgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o0nJ (J:)
    akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
    fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
    dsvesankeislwftpeeicewtsaqhkwvyeq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4o0nK (K:)
    maakqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgk
    pffpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivh
    gsdsvesankeislwftpeeicewtsaqhkwvyeqgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o0nK (K:)
    akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
    fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
    dsvesankeislwftpeeicewtsaqhkwvyeq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4o0nL (L:)
    maakqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgk
    pffpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivh
    gsdsvesankeislwftpeeicewtsaqhkwvyeqgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o0nL (L:)
    akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
    fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
    dsvesankeislwftpeeicewtsaqhkwvyeq