PDB entry 4o0a

View 4o0a on RCSB PDB site
Description: Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein Interactions
Class: DNA BINDING protein/inhibitor
Keywords: OB-Fold, Protein-Protein Interaction, DNA BINDING protein-inhibitor complex
Deposited on 2013-12-13, released 2014-01-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication protein A 70 kDa DNA-binding subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: RPA1, REPA1, RPA70
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27694 (3-122)
      • expression tag (0-2)
      • engineered mutation (9)
    Domains in SCOPe 2.08: d4o0aa1, d4o0aa2
  • Heterogens: 2P9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4o0aA (A:)
gshmvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfm
latqlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvp
yne