PDB entry 4nzi

View 4nzi on RCSB PDB site
Description: Crystal structure of murine neuroglobin mutant V140W
Class: transport protein
Keywords: Globin, oxygen transporter, TRANSPORT PROTEIN
Deposited on 2013-12-12, released 2014-06-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97
      • engineered mutation (57)
      • engineered mutation (122)
      • engineered mutation (142)
    Domains in SCOPe 2.04: d4nzia_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nziA (A:)
    gshmerpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedsls
    spefldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllyml
    ekslgpdftpatrtawsrlygawvqamsrgwdge
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nziA (A:)
    rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
    dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
    pdftpatrtawsrlygawvqamsrgwdg