PDB entry 4nz8

View 4nz8 on RCSB PDB site
Description: Crystal structure of porcine aminopeptidase-N complexed with cleaved poly-alanine
Class: hydrolase
Keywords: zinc aminopeptidase, hydrolase
Deposited on 2013-12-11, released 2013-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.153
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Sus scrofa [TaxId:9823]
    Gene: ANPEP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15145 (0-899)
      • conflict (43)
      • expression tag (900)
    Domains in SCOPe 2.07: d4nz8a1, d4nz8a2, d4nz8a3, d4nz8a4, d4nz8a5
  • Chain 'B':
    Compound: CLEAVED poly-Ala
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NZ8
  • Chain 'C':
    Compound: CLEAVED poly-Ala
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NZ8 (0-5)
  • Heterogens: NAG, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nz8A (A:)
    skpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskkl
    nyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgelad
    dlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsn
    mppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarpna
    iaeghgmyalnvtgpilnffanhyntsyplpksdqialpdfnagamenwglvtyrenall
    fdpqsssisnkervvtviahelahqwfgnlvtlawwndlwlnegfasyveylgadhaept
    wnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirmls
    nfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlqm
    gfpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsq
    aqndlfktasddwvllnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviydsf
    nlatahmvpvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkqv
    eplfqhfetltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpenn
    pihpnlrstiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnrylg
    ytlnpdlirkqdatstinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqgvt
    rrfssefelqqleqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfiehs
    shhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nz8A (A:)
    skpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskkl
    nyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgelad
    dlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsn
    mppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarpna
    iaeghgmyalnvtgpilnffanhyntsyplpksdqialpdfnagamenwglvtyrenall
    fdpqsssisnkervvtviahelahqwfgnlvtlawwndlwlnegfasyveylgadhaept
    wnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirmls
    nfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlqm
    gfpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsq
    aqndlfktasddwvllnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviydsf
    nlatahmvpvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkqv
    eplfqhfetltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpenn
    pihpnlrstiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnrylg
    ytlnpdlirkqdatstinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqgvt
    rrfssefelqqleqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfiehs
    s
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.