PDB entry 4nyr

View 4nyr on RCSB PDB site
Description: in-vivo crystallisation (midguts of a viviparous cockroach) and structure at 2.5 a resolution of a glycosylated, lipid-binding, lipocalin-like protein
Deposited on 2013-12-11, released 2014-01-01
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Milk protein
    Species: Diploptera punctata [TaxId:6984]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4nyrA (A:)
iaailvanakepcppenlqltpralvgkwylrttspdifkqvsnitefysahgndyygtv
tdyspeygleahrvnltvsgrtlkfymndtheydskyeilavdkdyfifyghppaapsgl
alihyrqscpkedvikrvkkalknvcldykyfgndtsvpchyve

    Sequence, based on observed residues (ATOM records):
    >4nyrA (A:)
kepcppenlqltpralvgkwylrttspdifkqvsnitefysahgndyygtvtdyspeygl
eahrvnltvsgrtlkfymndtheydskyeilavdkdyfifyghppaapsglalihyrqsc
pkedvikrvkkalknvcldykyfgndtsvpchy