PDB entry 4nyp

View 4nyp on RCSB PDB site
Description: The 2.0 Angstrom Crystal Structure of Pyrococcus Horikoshii Cuta1 Complexed With NA+
Class: metal binding protein
Keywords: Cuta, Trimer, Divalent Cation Tolerance, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2013-12-11, released 2014-01-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.03: d4nypa_
• Chain 'B':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.03: d4nypb_
• Chain 'C':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.03: d4nypc_
• Chain 'D':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.03: d4nypd_
• Chain 'E':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.03: d4nype_
• Chain 'F':
  Compound: Divalent-cation tolerance protein cutA
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: cutA, PH0992
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58720 (0-101)
  Domains in SCOPe 2.03: d4nypf_
• Heterogens: NA, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nypA (A:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nypB (B:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nypC (C:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nypD (D:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nypE (E:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nypF (F:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk