PDB entry 4nyp
View 4nyp on RCSB PDB site
Description: The 2.0 Angstrom Crystal Structure of Pyrococcus Horikoshii Cuta1 Complexed With NA+
Class: metal binding protein
Keywords: Cuta, Trimer, Divalent Cation Tolerance, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on
2013-12-11, released
2014-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2014-11-12, with a file datestamp of
2014-11-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Divalent-cation tolerance protein cutA
Species: Pyrococcus horikoshii [TaxId:70601]
Gene: cutA, PH0992
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4nypa_ - Chain 'B':
Compound: Divalent-cation tolerance protein cutA
Species: Pyrococcus horikoshii [TaxId:70601]
Gene: cutA, PH0992
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4nypb_ - Chain 'C':
Compound: Divalent-cation tolerance protein cutA
Species: Pyrococcus horikoshii [TaxId:70601]
Gene: cutA, PH0992
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4nypc_ - Chain 'D':
Compound: Divalent-cation tolerance protein cutA
Species: Pyrococcus horikoshii [TaxId:70601]
Gene: cutA, PH0992
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4nypd_ - Chain 'E':
Compound: Divalent-cation tolerance protein cutA
Species: Pyrococcus horikoshii [TaxId:70601]
Gene: cutA, PH0992
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4nype_ - Chain 'F':
Compound: Divalent-cation tolerance protein cutA
Species: Pyrococcus horikoshii [TaxId:70601]
Gene: cutA, PH0992
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4nypf_ - Heterogens: NA, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4nypA (A:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4nypB (B:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>4nypC (C:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>4nypD (D:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>4nypE (E:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>4nypF (F:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk