PDB entry 4nyl

View 4nyl on RCSB PDB site
Description: Crystal structure of adalimumab FAB fragment
Class: immune system
Keywords: immunoglobulin folding, antibody fragment, TNF alpha, IMMUNE SYSTEM
Deposited on 2013-12-10, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.277
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adalimumab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NYL (0-End)
  • Chain 'B':
    Compound: Adalimumab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NYL (0-End)
    Domains in SCOPe 2.07: d4nylb1
  • Chain 'C':
    Compound: Adalimumab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NYL (0-End)
  • Chain 'D':
    Compound: Adalimumab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NYL (0-End)
    Domains in SCOPe 2.07: d4nyld1, d4nyld2
  • Chain 'E':
    Compound: Adalimumab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NYL (0-End)
  • Chain 'F':
    Compound: Adalimumab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NYL (0-End)
    Domains in SCOPe 2.07: d4nylf1
  • Chain 'H':
    Compound: Adalimumab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NYL (0-End)
  • Chain 'L':
    Compound: Adalimumab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4NYL
    Domains in SCOPe 2.07: d4nyll1, d4nyll2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nylB (B:)
    diqmtqspsslsasvgdrvtitcrasqgirnylawyqqkpgkapklliyaastlqsgvps
    rfsgsgsgtdftltisslqpedvatyycqrynrapytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nylB (B:)
    diqmtqspsslsasvgdrvtitcrasqgirnylawyqqkpgkapklliyaastlqsgvps
    rfsgsgsgtdftltisslqpedvatyycqrynrapytfgqgtkveikrtvaapsvfi
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nylD (D:)
    diqmtqspsslsasvgdrvtitcrasqgirnylawyqqkpgkapklliyaastlqsgvps
    rfsgsgsgtdftltisslqpedvatyycqrynrapytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nylD (D:)
    diqmtqspsslsasvgdrvtitcrasqgirnylawyqqkpgkapklliyaastlqsgvps
    rfsgsgsgtdftltisslqpedvatyycqrynrapytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4nylF (F:)
    diqmtqspsslsasvgdrvtitcrasqgirnylawyqqkpgkapklliyaastlqsgvps
    rfsgsgsgtdftltisslqpedvatyycqrynrapytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nylF (F:)
    diqmtqspsslsasvgdrvtitcrasqgirnylawyqqkpgkapklliyaastlqsgvps
    rfsgsgsgtdftltisslqpedvatyycqrynrapytfgqgtkveikrtsvteqdskdst
    ysls
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4nylL (L:)
    diqmtqspsslsasvgdrvtitcrasqgirnylawyqqkpgkapklliyaastlqsgvps
    rfsgsgsgtdftltisslqpedvatyycqrynrapytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nylL (L:)
    iqmtqspsslsasvgdrvtitcrasqgirnylawyqqkpgkapklliyaastlqsgvpsr
    fsgsgsgtdftltisslqpedvatyycqrynrapytfgqgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg