PDB entry 4nyf

View 4nyf on RCSB PDB site
Description: HIV integrase in complex with inhibitor
Class: transferase/transferase inhibitor
Keywords: Allosteric Inhibitor, NCINI, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-12-10, released 2014-06-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Human immunodeficiency virus type 1 [TaxId:82834]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6F2 (Start-167)
      • engineered mutation (13)
      • engineered mutation (88)
      • engineered mutation (142)
    Domains in SCOPe 2.06: d4nyfa_
  • Chain 'B':
    Compound: integrase
    Species: Human immunodeficiency virus type 1 [TaxId:82834]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6F2
      • engineered mutation (13)
      • engineered mutation (88)
      • engineered mutation (96)
      • engineered mutation (142)
    Domains in SCOPe 2.06: d4nyfb_
  • Heterogens: 4BI, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nyfA (A:)
    glvprgshmgqvdsspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfll
    klagrwpvktihtdngsnftsatvkaacdwagikqedgipynpqsqgvvesmnkelkkii
    gqvrdqaehlktavqmavfihnkkrkggiggysagerivdiiatdiqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nyfA (A:)
    sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
    dngsnftsatvkaacdwagikqepqsqgvvesmnkelkkiigqvrdqaehlktavqmavf
    ihnkkrkggiggysagerivdiiatdiqt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nyfB (B:)
    glvprgshmgqvdsspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfll
    klagrwpvktihtdngsnftsatvkaacdwagikqedgipynpqsqgvvesmnkelkkii
    gqvrdqaehlktavqmavfihnkkrkggiggysagerivdiiatdiqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nyfB (B:)
    sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
    dngsnftsatvkaacdwagikqedgipynpesmnkelkkiigqvrdqaehlktavqmavf
    ihnkkrysagerivdiiatd