PDB entry 4ny7

View 4ny7 on RCSB PDB site
Description: Bond length analysis of the PqqC Y175F mutant structure shows evidence for bound PQQ in the reduced form
Class: Oxidoreductase
Keywords: all helical, Oxidoreductase
Deposited on 2013-12-10, released 2015-03-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyrroloquinoline-quinone synthase
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: pqqC, KPN78578_17810, KPN_01811
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6T9H1 (Start-250)
      • engineered mutation (174)
      • expression tag (251-254)
    Domains in SCOPe 2.06: d4ny7a1, d4ny7a2
  • Chain 'B':
    Compound: Pyrroloquinoline-quinone synthase
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: pqqC, KPN78578_17810, KPN_01811
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6T9H1 (Start-250)
      • engineered mutation (174)
      • expression tag (251-254)
    Domains in SCOPe 2.06: d4ny7b1, d4ny7b2
  • Heterogens: PQQ, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ny7A (A:)
    mlitdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplk
    daaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpg
    vrfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfffrsrl
    sqanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvt
    dkaawhttrlvlehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ny7A (A:)
    litdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkd
    aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
    rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfffrsrls
    qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
    kaawhttrlvlehh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ny7B (B:)
    mlitdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplk
    daaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpg
    vrfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfffrsrl
    sqanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvt
    dkaawhttrlvlehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ny7B (B:)
    litdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkd
    aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
    rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfffrsrls
    qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
    kaawhttrlvlehh