PDB entry 4nxo

View 4nxo on RCSB PDB site
Description: crystal structure of insulin degrading enzyme in complex with bdm44768
Deposited on 2013-12-09, released 2015-10-07
The last revision was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin-degrading enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: IDE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14735
      • engineered mutation (80-81)
      • engineered mutation (141)
      • engineered mutation (148)
      • engineered mutation (227)
      • engineered mutation (384)
      • engineered mutation (543)
      • engineered mutation (560)
      • engineered mutation (759)
      • engineered mutation (782)
      • engineered mutation (789)
      • engineered mutation (874)
      • engineered mutation (936)
  • Chain 'B':
    Compound: Insulin-degrading enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: IDE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14735
      • engineered mutation (80-81)
      • engineered mutation (141)
      • engineered mutation (148)
      • engineered mutation (227)
      • engineered mutation (384)
      • engineered mutation (543)
      • engineered mutation (560)
      • engineered mutation (759)
      • engineered mutation (782)
      • engineered mutation (789)
      • engineered mutation (874)
  • Heterogens: ZN, 2H7, 1PE, PEG, EDO, EPE, DIO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4nxoA (A:)
    mhhhhhhaagipmnnpaikrignhitkspedkreyrglelangikvllisdpttdkssaa
    ldvhigslsdppniaglshflqhmlflgtkkypkeneysqflsehagssnaftsgehtny
    yfdvshehlegaldrfaqfflsplfdesakdrevnavdseheknvmndawrlfqlekatg
    npkhpfskfgtgnkytletrpnqegidvrqellkfhsayyssnlmavvvlgreslddltn
    lvvklfsevenknvplpefpehpfqeehlkqlykivpikdirnlyvtfpipdlqkyyksn
    pghylghlighegpgsllselkskgwvntlvggqkegargfmffiinvdlteegllhved
    iilhmfqyiqklraegpqewvfqelkdlnavafrfkdkerprgytskiagilhyypleev
    ltaeylleefrpdliemvldklrpenvrvaivsksfegktdrteewygtqykqeaipdev
    ikkwqnadlngkfklptknefiptnfeilplekeatpypalikdtamsklwfkqddkffl
    pkanlnfeffspfayvdplhsnmaylylellkdslneyayaaelaglsydlqntiygmyl
    svkgyndkqpillkkiiekmatfeidekrfeiikeaymrslnnfraeqphqhamyylrll
    mtevawtkdelkealddvtlprlkafipqllsrlhieallhgnitkqaalgimqmvedtl
    iehahtkpllpsqlvryrevqlpdrgwfvyqqrnevhnnsgieiyyqtdmqstsenmfle
    lfaqiisepafntlrtkeqlgyivfsgprrangiqglrfiiqsekpphylesrveaflit
    meksiedmteeafqkhiqalairrldkpkklsaesakywgeiisqqynfdrdntevaylk
    tltkediikfykemlavdaprrhkvsvhvlaremdsnpvvgefpaqndinlsqapalpqp
    eviqnmtefkrglplfplvkphinfmaakl
    

    Sequence, based on observed residues (ATOM records):
    >4nxoA (A:)
    nnpaikrignhitkspedkreyrglelangikvllisdpttdkssaaldvhigslsdppn
    iaglshflqhmlflgtkkypkeneysqflsehagssnaftsgehtnyyfdvshehlegal
    drfaqfflsplfdesakdrevnavdseheknvmndawrlfqlekatgnpkhpfskfgtgn
    kytletrpnqegidvrqellkfhsayyssnlmavvvlgreslddltnlvvklfsevenkn
    vplpefpehpfqeehlkqlykivpikdirnlyvtfpipdlqkyyksnpghylghligheg
    pgsllselkskgwvntlvggqkegargfmffiinvdlteegllhvediilhmfqyiqklr
    aegpqewvfqelkdlnavafrfkdkerprgytskiagilhyypleevltaeylleefrpd
    liemvldklrpenvrvaivsksfegktdrteewygtqykqeaipdevikkwqnadlngkf
    klptknefiptnfeilplekeatpypalikdtamsklwfkqddkfflpkanlnfeffspf
    ayvdplhsnmaylylellkdslneyayaaelaglsydlqntiygmylsvkgyndkqpill
    kkiiekmatfeidekrfeiikeaymrslnnfraeqphqhamyylrllmtevawtkdelke
    alddvtlprlkafipqllsrlhieallhgnitkqaalgimqmvedtliehahtkpllpsq
    lvryrevqlpdrgwfvyqqrnevhnnsgieiyyqtdmqstsenmflelfaqiisepafnt
    lrtkeqlgyivfsgprrangiqglrfiiqsekpphylesrveaflitmeksiedmteeaf
    qkhiqalairrldkpkklsaesakywgeiisqqynfdrdntevaylktltkediikfyke
    mlavdaprrhkvsvhvlaremdsnpvlsqapalpqpeviqnmtefkrglplfplvkph
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4nxoB (B:)
    mhhhhhhaagipmnnpaikrignhitkspedkreyrglelangikvllisdpttdkssaa
    ldvhigslsdppniaglshflqhmlflgtkkypkeneysqflsehagssnaftsgehtny
    yfdvshehlegaldrfaqfflsplfdesakdrevnavdseheknvmndawrlfqlekatg
    npkhpfskfgtgnkytletrpnqegidvrqellkfhsayyssnlmavvvlgreslddltn
    lvvklfsevenknvplpefpehpfqeehlkqlykivpikdirnlyvtfpipdlqkyyksn
    pghylghlighegpgsllselkskgwvntlvggqkegargfmffiinvdlteegllhved
    iilhmfqyiqklraegpqewvfqelkdlnavafrfkdkerprgytskiagilhyypleev
    ltaeylleefrpdliemvldklrpenvrvaivsksfegktdrteewygtqykqeaipdev
    ikkwqnadlngkfklptknefiptnfeilplekeatpypalikdtamsklwfkqddkffl
    pkanlnfeffspfayvdplhsnmaylylellkdslneyayaaelaglsydlqntiygmyl
    svkgyndkqpillkkiiekmatfeidekrfeiikeaymrslnnfraeqphqhamyylrll
    mtevawtkdelkealddvtlprlkafipqllsrlhieallhgnitkqaalgimqmvedtl
    iehahtkpllpsqlvryrevqlpdrgwfvyqqrnevhnnsgieiyyqtdmqstsenmfle
    lfaqiisepafntlrtkeqlgyivfsgprrangiqglrfiiqsekpphylesrveaflit
    meksiedmteeafqkhiqalairrldkpkklsaesakywgeiisqqynfdrdntevaylk
    tltkediikfykemlavdaprrhkvsvhvlaremdsnpvvgefpaqndinlsqapalpqp
    eviqnmtefkrglplfplvkphinfmaakl
    

    Sequence, based on observed residues (ATOM records):
    >4nxoB (B:)
    nnpaikrignhitkspedkreyrglelangikvllisdpttdkssaaldvhigslsdppn
    iaglshflqhmlflgtkkypkeneysqflsehagssnaftsgehtnyyfdvshehlegal
    drfaqfflsplfdesakdrevnavdseheknvmndawrlfqlekatgnpkhpfskfgtgn
    kytletrpnqegidvrqellkfhsayyssnlmavvvlgreslddltnlvvklfsevenkn
    vplpefpehpfqeehlkqlykivpikdirnlyvtfpipdlqkyyksnpghylghligheg
    pgsllselkskgwvntlvggqkegargfmffiinvdlteegllhvediilhmfqyiqklr
    aegpqewvfqelkdlnavafrfkdkerprgytskiagilhyypleevltaeylleefrpd
    liemvldklrpenvrvaivsksfegktdrteewygtqykqeaipdevikkwqnadlngkf
    klptknefiptnfeilplekeatpypalikdtamsklwfkqddkfflpkanlnfeffspf
    ayvdplhsnmaylylellkdslneyayaaelaglsydlqntiygmylsvkgyndkqpill
    kkiiekmatfeidekrfeiikeaymrslnnfraeqphqhamyylrllmtevawtkdelke
    alddvtlprlkafipqllsrlhieallhgnitkqaalgimqmvedtliehahtkpllpsq
    lvryrevqlpdrgwfvyqqrnevhnnsgieiyyqtdmqstsenmflelfaqiisepafnt
    lrtkeqlgyivfsgprrangiqglrfiiqsekpphylesrveaflitmeksiedmteeaf
    qkhiqalairrldkpkklsaesakywgeiisqqynfdrdntevaylktltkediikfyke
    mlavdaprrhkvsvhvlaremdsnlsqapalpqpeviqnmtefkrglplfplvkph