PDB entry 4nxj

View 4nxj on RCSB PDB site
Description: Crystal Structure of PF3D7_1475600, a bromodomain from Plasmodium Falciparum
Class: DNA binding protein
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, bromodomain, DNA BINDING PROTEIN
Deposited on 2013-12-09, released 2014-03-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.205
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain protein
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0724
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IK82 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d4nxja_
  • Chain 'B':
    Compound: Bromodomain protein
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0724
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IK82 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d4nxjb_
  • Chain 'C':
    Compound: Bromodomain protein
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0724
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IK82 (1-End)
      • expression tag (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nxjA (A:)
    gydeieelksknevltnllnkliafdkkriflypvnvqlvpdylnvikepmdfttmkqkl
    qnfkyksfqefekdvlliinncytyndpstiyykfaedietyykklnikiqtkymnihl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nxjA (A:)
    gydeieelksknevltnllnkliafdkkriflypvnvqlvpdylnvikepmdfttmkqkl
    qnfkyksfqefekdvlliinncytyndpstiyykfaedietyykklnikiqtkymnih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nxjB (B:)
    gydeieelksknevltnllnkliafdkkriflypvnvqlvpdylnvikepmdfttmkqkl
    qnfkyksfqefekdvlliinncytyndpstiyykfaedietyykklnikiqtkymnihl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nxjB (B:)
    gydeieelksknevltnllnkliafdkkriflypvnvqlvpdylnvikepmdfttmkqkl
    qnfkyksfqefekdvlliinncytyndpstiyykfaedietyykklnikiqtkymni
    

  • Chain 'C':
    No sequence available.