PDB entry 4nxg

View 4nxg on RCSB PDB site
Description: Crystal structure of iLOV-I486z(2LT) at pH 9.0
Class: flavoprotein, fluorescent protein
Keywords: flavoprotein, FMN binding, FLUORESCENT PROTEIN
Deposited on 2013-12-09, released 2014-09-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.199
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phototropin-2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PHOT2, CAV1, KIN7, NPL1, At5g58140, K21L19.6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P93025
      • engineered mutation (7)
      • engineered mutation (22)
      • see remark 999 (39)
      • engineered mutation (65)
      • engineered mutation (83)
      • engineered mutation (88)
      • engineered mutation (99)
    Domains in SCOPe 2.08: d4nxga_
  • Chain 'B':
    Compound: Phototropin-2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PHOT2, CAV1, KIN7, NPL1, At5g58140, K21L19.6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P93025 (1-End)
      • engineered mutation (7)
      • engineered mutation (22)
      • see remark 999 (39)
      • engineered mutation (65)
      • engineered mutation (83)
      • engineered mutation (88)
      • engineered mutation (99)
    Domains in SCOPe 2.08: d4nxgb_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4nxgA (A:)
meknfvitdprlpdnpiifasdgflelteysreeilgrnarflqgpetdqatvqkirdai
rdqrettvqlinytksgkkfwnllhlqpvrdqkgelqyfxgvqldgsdhvlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4nxgA (A:)
knfvitdprlpdnpiifasdgflelteysreeilgrnarflqgpetdqatvqkirdaird
qrettvqlinytksgkkfwnllhlqpvrdqkgelqyfxgvqld

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4nxgB (B:)
meknfvitdprlpdnpiifasdgflelteysreeilgrnarflqgpetdqatvqkirdai
rdqrettvqlinytksgkkfwnllhlqpvrdqkgelqyfxgvqldgsdhvlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4nxgB (B:)
eknfvitdprlpdnpiifasdgflelteysreeilgrnarflqgpetdqatvqkirdair
dqrettvqlinytksgkkfwnllhlqpvrdqkgelqyfxgvqld