PDB entry 4nx9

View 4nx9 on RCSB PDB site
Description: Crystal structure of Pseudomonas aeruginosa flagellin FliC
Deposited on 2013-12-09, released 2014-01-29
The last revision was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.164
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: FliC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O86266
      • engineered mutation (146)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4nx9A (A:)
    gsakdpsqvnglnvatknandgislaqtaegalqqstnilqrmrdlslqsangsnsdser
    talngevkqlqkeldrisntttfggrklldgsfgvasfqvgsaaneiisvgidemsaesl
    ngtyfkadgggavtaatasgtvdiaiditggsavnvkvdmkgnetaeqaaakiaaavnda
    nvgigaftdgaqisyvskasadgttsavsgvaitdtgstgagtaagtttfteandtvaki
    distakgaqsavlvideaikqidaqradlgavqnrfdntinnlknigenvsaa
    

    Sequence, based on observed residues (ATOM records):
    >4nx9A (A:)
    nglnvatknandgislaqtaegalqqstnilqrmrdlslqsangsnsdsertalngevkq
    lqkeldrisntttfggrklldgsfgvasfqvgsaaneiisvgidemsaeslngtyfkadg
    ggavtaatasgtvdiaiditggsavnvkvdmkgnetaeqaaakiaaavndanvgigaftd
    gaqisyvskasadgttsavsgvaitdtgstgagtaagtttfteandtvakidistakgaq
    savlvideaikqidaqradlgavqnrfdntinnlkni