PDB entry 4nwi

View 4nwi on RCSB PDB site
Description: Crystal structure of cytosolic 5'-nucleotidase IIIB (cN-IIIB) bound to cytidine
Class: Hydrolase
Keywords: Rossmannoid fold, 5'-nucleotidase, Hydrolase
Deposited on 2013-12-06, released 2014-03-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.228
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7-methylguanosine phosphate-specific 5'-nucleotidase
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG3362
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nwia_
  • Chain 'B':
    Compound: 7-methylguanosine phosphate-specific 5'-nucleotidase
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG3362
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nwib_
  • Heterogens: MG, CTN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nwiA (A:)
    mgfdekreptggrlrlqdipaltqdhcrmrdpaeveriinefviggpermqivsdfdyti
    tkqrtedggavpssfgifnacqslpenfkaetdklyhkyrpieidphmpiaekvqymiew
    wtksgeltsgfpfdqseidqiaskythalrdrtheffadlqrlgiptlvfsaglgnsvvs
    vlrqanvlhpnvkvvsnflqfrdglldgfqqpmihtfnknetvlnetseyydlvhtrdhi
    ivmgdsigdadmasgvpasshimkigflfdhveanmkkymdtfdivlvddqtmdvprtll
    sliekqhklnleapkqssl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nwiA (A:)
    rlrlqdipaltqdhcrmrdpaeveriinefviggpermqivsdfdytitkqrtedggavp
    ssfgifnacqslpenfkaetdklyhkyrpieidphmpiaekvqymiewwtksgeltsgfp
    fdqseidqiaskythalrdrtheffadlqrlgiptlvfsaglgnsvvsvlrqanvlhpnv
    kvvsnflqfrdglldgfqqpmihtfnknetvlnetseyydlvhtrdhiivmgdsigdadm
    asgvpasshimkigflfdhveanmkkymdtfdivlvddqtmdvprtllsliekqhkln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nwiB (B:)
    mgfdekreptggrlrlqdipaltqdhcrmrdpaeveriinefviggpermqivsdfdyti
    tkqrtedggavpssfgifnacqslpenfkaetdklyhkyrpieidphmpiaekvqymiew
    wtksgeltsgfpfdqseidqiaskythalrdrtheffadlqrlgiptlvfsaglgnsvvs
    vlrqanvlhpnvkvvsnflqfrdglldgfqqpmihtfnknetvlnetseyydlvhtrdhi
    ivmgdsigdadmasgvpasshimkigflfdhveanmkkymdtfdivlvddqtmdvprtll
    sliekqhklnleapkqssl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nwiB (B:)
    rlrlqdipaltqdhcrmrdpaeveriinefviggpermqivsdfdytitkqrtedggavp
    ssfgifnacqslpenfkaetdklyhkyrpieidpaekvqymiewwtksgeltsgfpfdqs
    eidqiaskythalrdrtheffadlqrlgiptlvfsaglgnsvvsvlrqanvlhpnvkvvs
    nflqfrdglldgfqqpmihtfnknetvlnetseyydlvhtrdhiivmgdsigdadmasgv
    passhimkigflfdhveanmkkymdtfdivlvddqtmdvprtllsliekqhklnle