PDB entry 4nwg

View 4nwg on RCSB PDB site
Description: Crystal structure of the tyrosine phosphatase SHP-2 with E139D mutation
Class: Hydrolase
Keywords: Hydrolase
Deposited on 2013-12-06, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.281
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (138)
    Domains in SCOPe 2.07: d4nwga1, d4nwga2, d4nwga3
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (138)
    Domains in SCOPe 2.07: d4nwgb1, d4nwgb2, d4nwgb3
  • Heterogens: EDO, PEG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nwgA (A:)
    mtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntg
    dyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvrdsqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaett
    dkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpnep
    vsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttkev
    ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
    rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiir
    ekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrieeeqkskrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nwgA (A:)
    tsrrwfhpnitgveaenllltrgvdgsflarpsnpgdftlsvrrngavthikiqntgdyy
    dlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgaekl
    ltekgkhgsflvrdsqshpgdfvlsvrtgdskvthvmircqelkydvgggerfdsltdlv
    ehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsgfweefetlqqqeckllysr
    kegqrqenknknryknilpfdhtrvvlhdgdpnpvsdyinaniimpekksyiatqgclqn
    tvndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdy
    tlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvv
    vhcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiym
    avqhyietlqrrieeeqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nwgB (B:)
    mtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntg
    dyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvrdsqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaett
    dkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpnep
    vsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttkev
    ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
    rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiir
    ekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrieeeqkskrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nwgB (B:)
    tsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgd
    yydlygekfatlaelvqyymehhgqlvielkyplncadptserwfhghlsgeaeklltek
    gkhgsflvrdsqshpgdfvlsvrtgdskvthvmircqelkydvgggerfdsltdlvehyk
    knpmvetlgtvlqlkqplnttrinaaeiesrvrelsgfweefetlqqqeckllysrkegq
    rqenknknryknilpfdhtrvvlhdgdpnpvsdyinaniimpeksyiatqgclqntvndf
    wrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrel
    klskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsa
    gigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhy
    ietlqrrieeeq