PDB entry 4nwf

View 4nwf on RCSB PDB site
Description: Crystal structure of the tyrosine phosphatase SHP-2 with N308D mutation
Class: hydrolase
Keywords: hydrolase
Deposited on 2013-12-06, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.267
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (307)
    Domains in SCOPe 2.07: d4nwfa1, d4nwfa2, d4nwfa3
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (307)
    Domains in SCOPe 2.07: d4nwfb1, d4nwfb2, d4nwfb3
  • Heterogens: EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nwfA (A:)
    mtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntg
    dyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaett
    dkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpnep
    vsdyinadiimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttkev
    ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
    rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiir
    ekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrieeeqkskrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nwfA (A:)
    srrwfhpnitgveaenllltrgvdgsflarpsgdftlsvrrngavthikiqntgdyydly
    ggekfatlaelvqyymehhgqlkevielkyplncadptserwfhghlsgkeaeklltekg
    khgsflvresqshpgdfvlsvrtgdskvthvmircqelkydvgggerfdsltdlvehykk
    npmvetlgtvlqlkqplnttrinaaeiesrvrelsgfweefetlqqqeckllysrkegqr
    qenknknryknilpfdhtrvvlhdgdpvsdyinadiimpeksyiatqgclqntvndfwrm
    vfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelkls
    kvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagig
    rtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyiet
    lqrrieeeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nwfB (B:)
    mtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntg
    dyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaett
    dkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpnep
    vsdyinadiimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttkev
    ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
    rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiir
    ekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrieeeqkskrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nwfB (B:)
    srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
    ydlyggekfatlaelvqyymehgqlkvielkyplncadptserwfhghlsgkeaekllte
    kgkhgsflvresqshpgdfvlsvrtgddgkskvthvmircqelkydvgggerfdsltdlv
    ehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskgfweefetlqqqeckllys
    rkegqrqenknknryknilpfdhtrvvlhdgdpnvsdyinadiimpeksyiatqgclqnt
    vndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdyt
    lrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvv
    hcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiyma
    vqhyietlqrrieeeq