PDB entry 4nvt

View 4nvt on RCSB PDB site
Description: Crystal Structure of Triosephosphate Isomerase from Brucella melitensis
Class: isomerase
Keywords: SSGCID, Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, ISOMERASE
Deposited on 2013-12-05, released 2013-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.179
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Brucella melitensis [TaxId:546272]
    Gene: BMEA_A1182, tpiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nvta_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Brucella melitensis [TaxId:546272]
    Gene: BMEA_A1182, tpiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nvtb_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Brucella melitensis [TaxId:546272]
    Gene: BMEA_A1182, tpiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nvtc_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Brucella melitensis [TaxId:546272]
    Gene: BMEA_A1182, tpiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nvtd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nvtA (A:)
    mahhhhhhmtpgirplvagnwkmngkgesltelraiaaglssdlgrkldavicvpatlls
    raaetlegetvglggqdahfktsgahtgdispemlkeagathvilghserrtdhhesnkl
    icakteaawaaglvaivcvgetaserkaeraldvigdqlsgslpdgvtaentiiayepvw
    aigtgltptvqdvraahafmreqlierfgakgahlrllyggsvkpsnaaellgvadvdga
    lvggaslkaadflaicetyrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nvtA (A:)
    irplvagnwkmngkgesltelraiaaglssdlgrkldavicvpatllsraaetlegetvg
    lggqdahfktsgahtgdispemlkeagathvilghserrtdhhesnklicakteaawaag
    lvaivcvgetaserkaeraldvigdqlsgslpdgvtaentiiayepvwaigtgltptvqd
    vraahafmreqlierfgakgahlrllyggsvkpsnaaellgvadvdgalvggaslkaadf
    laicetyrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nvtB (B:)
    mahhhhhhmtpgirplvagnwkmngkgesltelraiaaglssdlgrkldavicvpatlls
    raaetlegetvglggqdahfktsgahtgdispemlkeagathvilghserrtdhhesnkl
    icakteaawaaglvaivcvgetaserkaeraldvigdqlsgslpdgvtaentiiayepvw
    aigtgltptvqdvraahafmreqlierfgakgahlrllyggsvkpsnaaellgvadvdga
    lvggaslkaadflaicetyrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nvtB (B:)
    irplvagnwkmngkgesltelraiaaglssdlgrkldavicvpatllsraaetlegetvg
    lggqdahfktsgahtgdispemlkeagathvilghserrtdhhesnklicakteaawaag
    lvaivcvgetaserkaeraldvigdqlsgslpdgvtaentiiayepvwaigtgltptvqd
    vraahafmreqlierfgakgahlrllyggsvkpsnaaellgvadvdgalvggaslkaadf
    laicetyr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nvtC (C:)
    mahhhhhhmtpgirplvagnwkmngkgesltelraiaaglssdlgrkldavicvpatlls
    raaetlegetvglggqdahfktsgahtgdispemlkeagathvilghserrtdhhesnkl
    icakteaawaaglvaivcvgetaserkaeraldvigdqlsgslpdgvtaentiiayepvw
    aigtgltptvqdvraahafmreqlierfgakgahlrllyggsvkpsnaaellgvadvdga
    lvggaslkaadflaicetyrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nvtC (C:)
    irplvagnwkmngkgesltelraiaaglssdlgrkldavicvpatllsraaetlegetvg
    lggqdahfktsgahtgdispemlkeagathvilghserrtdhhesnklicakteaawaag
    lvaivcvgetaserkaeraldvigdqlsgslpdgvtaentiiayepvwailtptvqdvra
    ahafmreqlierfgakgahlrllyggsvkpsnaaellgvadvdgalvggaslkaadflai
    cetyrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nvtD (D:)
    mahhhhhhmtpgirplvagnwkmngkgesltelraiaaglssdlgrkldavicvpatlls
    raaetlegetvglggqdahfktsgahtgdispemlkeagathvilghserrtdhhesnkl
    icakteaawaaglvaivcvgetaserkaeraldvigdqlsgslpdgvtaentiiayepvw
    aigtgltptvqdvraahafmreqlierfgakgahlrllyggsvkpsnaaellgvadvdga
    lvggaslkaadflaicetyrnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nvtD (D:)
    irplvagnwkmngkgesltelraiaaglssdlgrkldavicvpatllsraaetlegetvg
    lggqdahfktsgahtgdispemlkeagathvilghserrtdhhesnklicakteaawaag
    lvaivcvgetaserkaeraldvigdqlsgslpdgvtaentiiayepvwailtptvqdvra
    ahafmreqlierfgakgahlrllyggsvkpsnaaellgvadvdgalvggaslkaadflai
    cetyrn