PDB entry 4nvk

View 4nvk on RCSB PDB site
Description: Predicting protein conformational response in prospective ligand discovery.
Class: oxidoreductase
Keywords: Model system, flexibility, dynamic, loop, side-chains, energy penalty, occupancy, Boltzmann weights, flexible docking, ligand binding, OXIDOREDUCTASE
Deposited on 2013-12-05, released 2013-12-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.142
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:285006]
    Gene: CCP1 CCP CPO YKR066C, SCRG_04081
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3LRE1 (0-288)
      • engineered mutation (186-187)
    Domains in SCOPe 2.05: d4nvkb_
  • Heterogens: HEM, 2NY, PO4, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4nvkB (B:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
    sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl