PDB entry 4nvh

View 4nvh on RCSB PDB site
Description: Predicting protein conformational response in prospective ligand discovery
Class: oxidoreductase
Keywords: Model system, flexibility, dynamic, loop, side-chains, energy penalty, occupancy, Boltzmann weights, flexible docking, ligand binding, OXIDOREDUCTASE
Deposited on 2013-12-05, released 2013-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: cytochrome c peroxidase
  Species: Saccharomyces cerevisiae [TaxId:285006]
  Gene: CCP1 CCP CPO YKR066C, SCRG_04081
  Database cross-references and differences (RAF-indexed):
  • Uniprot B3LRE1 (0-288)
    • engineered mutation (186-187)
  Domains in SCOPe 2.08: d4nvhb_
• Heterogens: HEM, 2NB, HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4nvhB (B:)
  lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
  ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
  ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
  nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
  sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl