PDB entry 4nuw

View 4nuw on RCSB PDB site
Description: Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with uridine 5'-monophosphate
Class: lyase
Keywords: tim barrel, orotidine 5'-monophosphate decarboxylase, uridine 5'-monophosphate, LYASE
Deposited on 2013-12-04, released 2013-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.176
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • conflict (100)
    Domains in SCOPe 2.07: d4nuwa_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • conflict (100)
    Domains in SCOPe 2.07: d4nuwb_
  • Heterogens: U5P, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nuwA (A:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nuwA (A:)
    vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri
    iadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltems
    hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqgg
    dpgetlrfadaiivgrsiyladnpaaaaagiiesikdll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nuwB (B:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nuwB (B:)
    vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri
    iadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltems
    hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqgg
    dpgetlrfadaiivgrsiyladnpaaaaagiiesikdll