PDB entry 4nuj

View 4nuj on RCSB PDB site
Description: Crystal structure of HIV-1 broadly neutralizing antibody PGT152
Class: immune system
Keywords: immunoglobulin, Fab fragment, IMMUNE SYSTEM, HIV Envelope
Deposited on 2013-12-03, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PGT152 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4NUJ (0-110)
    • Uniprot Q8TCD0 (111-End)
    Domains in SCOPe 2.07: d4nuja1, d4nuja2
  • Chain 'B':
    Compound: PGT152 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: DKFZp686P15220
    Database cross-references and differences (RAF-indexed):
    • PDB 4NUJ (0-103)
    • Uniprot Q6N089 (103-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nujA (A:)
    divmtqtplslsvdpgqpasisckssqslrqsngktslywyqqkpgqspqllifevsnrf
    sgvsdrfvgsgsgtdftlrisrveaedvgfyycmqskdfpltfgggtkvdlkrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nujA (A:)
    divmtqtplslsvdpgqpasisckssqslrqsngktslywyqqkpgqspqllifevsnrf
    sgvsdrfvgsgsgtdftlrisrveaedvgfyycmqskdfpltfgggtkvdlkrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.