PDB entry 4nty

View 4nty on RCSB PDB site
Description: Cesium sites in the crystal structure of acid-sensing ion channel in complex with snake toxin
Class: transport protein/toxin
Keywords: Kunitz, phospholipase A2-like, ion channel, nociception, membrane, TRANSPORT PROTEIN-TOXIN complex
Deposited on 2013-12-02, released 2014-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Acid-sensing ion channel 1
  Species: Gallus gallus [TaxId:9031]
  Gene: ASIC1, ACCN2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q1XA76
• Chain 'B':
  Compound: Neurotoxin MitTx-alpha
  Species: Micrurus tener tener [TaxId:1114302]
  Database cross-references and differences (RAF-indexed):
  • Uniprot G9I929 (0-59)
  Domains in SCOPe 2.08: d4ntyb_
• Chain 'C':
  Compound: Basic phospholipase A2 homolog Tx-beta
  Species: Micrurus tener tener [TaxId:1114302]
  Database cross-references and differences (RAF-indexed):
  • Uniprot G9I930 (0-End)
  Domains in SCOPe 2.08: d4ntyc_
• Heterogens: CS, CL, PE4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ntyB (B:)
  eirpafcyedppffqkcgafvdsyyfnrsritcvhffygqcdvnqnhfttmsecnrvchg
  

  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >4ntyC (C:)
  nlnqfrlmikctndrvwadfvdygcycvardsntpvddldrccqaqkqcydeavkvhgck
  plvmfysfecrylasdldcsgnntkcrnfvcncdrtatlciltatynrnnhkidpsrcq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4ntyC (C:)
  nlnqfrlmikctndrvwadfvdygcycvardsntpvddldrccqaqkqcydeavkvhgck
  plvmfysfecrylasdldcsgnntkcrnfvcncdrtatlciltatynrnnhkidpsrc