PDB entry 4ntx

View 4ntx on RCSB PDB site
Description: Structure of acid-sensing ion channel in complex with snake toxin and amiloride
Class: transport protein/toxin
Keywords: Kunitz, phospholipase A2-like, ion channel, nociception, membrane, TRANSPORT PROTEIN-TOXIN complex
Deposited on 2013-12-02, released 2014-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acid-sensing ion channel 1
    Species: Gallus gallus [TaxId:9031]
    Gene: ASIC1, ACCN2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Neurotoxin MitTx-alpha
    Species: Micrurus tener tener [TaxId:1114302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ntxb_
  • Chain 'C':
    Compound: Basic phospholipase A2 homolog Tx-beta
    Species: Micrurus tener tener [TaxId:1114302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ntxc_
  • Heterogens: NAG, CL, NA, P6G, AMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ntxB (B:)
    eirpafcyedppffqkcgafvdsyyfnrsritcvhffygqcdvnqnhfttmsecnrvchg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ntxC (C:)
    nlnqfrlmikctndrvwadfvdygcycvardsntpvddldrccqaqkqcydeavkvhgck
    plvmfysfecrylasdldcsgnntkcrnfvcncdrtatlciltatynrnnhkidpsrcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ntxC (C:)
    nlnqfrlmikctndrvwadfvdygcycvardsntpvddldrccqaqkqcydeavkvhgck
    plvmfysfecrylasdldcsgnntkcrnfvcncdrtatlciltatynrnnhkidpsrc