PDB entry 4ntx
View 4ntx on RCSB PDB site
Description: Structure of acid-sensing ion channel in complex with snake toxin and amiloride
Class: transport protein/toxin
Keywords: Kunitz, phospholipase A2-like, ion channel, nociception, membrane, TRANSPORT PROTEIN-TOXIN complex
Deposited on
2013-12-02, released
2014-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-07-29, with a file datestamp of
2020-07-04.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.31
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Acid-sensing ion channel 1
Species: Gallus gallus [TaxId:9031]
Gene: ASIC1, ACCN2
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Neurotoxin MitTx-alpha
Species: Micrurus tener tener [TaxId:1114302]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4ntxb_ - Chain 'C':
Compound: Basic phospholipase A2 homolog Tx-beta
Species: Micrurus tener tener [TaxId:1114302]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4ntxc_ - Heterogens: NAG, CL, NA, P6G, AMR, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4ntxB (B:)
eirpafcyedppffqkcgafvdsyyfnrsritcvhffygqcdvnqnhfttmsecnrvchg
- Chain 'C':
Sequence, based on SEQRES records: (download)
>4ntxC (C:)
nlnqfrlmikctndrvwadfvdygcycvardsntpvddldrccqaqkqcydeavkvhgck
plvmfysfecrylasdldcsgnntkcrnfvcncdrtatlciltatynrnnhkidpsrcq
Sequence, based on observed residues (ATOM records): (download)
>4ntxC (C:)
nlnqfrlmikctndrvwadfvdygcycvardsntpvddldrccqaqkqcydeavkvhgck
plvmfysfecrylasdldcsgnntkcrnfvcncdrtatlciltatynrnnhkidpsrc