PDB entry 4nt5

View 4nt5 on RCSB PDB site
Description: crystal structure of human von willebrand factor ctck domain
Deposited on 2013-12-01, released 2014-01-01
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.28 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Gene: F8VWF, VWF
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, ZN, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4nt5A (A:)
hhhhhhlevlfqgpepecnditarlqyvkvgscksevevdihycqgkcaskamysidind
vqdqcsccsptrtepmqvalhctngsvvyhevlnameckcsprkcsk

    Sequence, based on observed residues (ATOM records):
    >4nt5A (A:)
epecnditarlqyvkvgscksevevdihycqgkcaskamysidindvqdqcsccsptrte
pmqvalhctngsvvyhevlnameckcsprkcsk