PDB entry 4nt0

View 4nt0 on RCSB PDB site
Description: Crystal structure of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with 3-deazauridine 5'-monophosphate
Class: lyase
Keywords: tim-barrel, orotidine 5'-monophosphate decarboxylase, 3-deazauridine 5'-monophosphate, LYASE
Deposited on 2013-11-29, released 2013-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4nt0a_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4nt0b_
  • Heterogens: 3DU, CA, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nt0A (A:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nt0A (A:)
    rsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrk
    rfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevf
    lltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispg
    etlrfadaiivgrsiyladnpaaaaagiiesik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nt0B (B:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nt0B (B:)
    rsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrk
    rfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevf
    lltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispg
    etlrfadaiivgrsiyladnpaaaaagiiesik