PDB entry 4ns2

View 4ns2 on RCSB PDB site
Description: Crystal structure of Horse heart ferric myoglobin; D44K/D60K/E85K mutant
Class: oxygen transport
Keywords: Oxygen transport
Deposited on 2013-11-27, released 2014-12-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: 0.171
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (Start-153)
      • engineered mutation (44)
      • engineered mutation (60)
      • engineered mutation (85)
    Domains in SCOPe 2.05: d4ns2a_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ns2A (A:)
    mglsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfkkfkhlkteaemkase
    klkkhgtvvltalggilkkkghheaklkplaqshatkhkipikylefisdaiihvlhskh
    pgdfgadaqgamtkalelfrndiaakykelgfqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ns2A (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfkkfkhlkteaemkasek
    lkkhgtvvltalggilkkkghheaklkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg