PDB entry 4ns1

View 4ns1 on RCSB PDB site
Description: Crystal structure of purine nucleoside phosphorylase from Porphyromonas gingivalis ATCC 33277, NYSGRC Target 30972
Class: transferase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NYSGRC, PSI-Biology, New York Structural Genomics Research Consortium, TRANSFERASE
Deposited on 2013-11-27, released 2013-12-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.172
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Porphyromonas gingivalis [TaxId:431947]
    Gene: PGN_1412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ns1a_
  • Chain 'B':
    Compound: purine nucleoside phosphorylase
    Species: Porphyromonas gingivalis [TaxId:431947]
    Gene: PGN_1412
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2RKN6 (22-294)
      • expression tag (20-21)
    Domains in SCOPe 2.05: d4ns1b_
  • Chain 'C':
    Compound: purine nucleoside phosphorylase
    Species: Porphyromonas gingivalis [TaxId:431947]
    Gene: PGN_1412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ns1c_
  • Chain 'D':
    Compound: purine nucleoside phosphorylase
    Species: Porphyromonas gingivalis [TaxId:431947]
    Gene: PGN_1412
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2RKN6 (22-294)
      • expression tag (19-21)
    Domains in SCOPe 2.05: d4ns1d_
  • Heterogens: DA, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ns1A (A:)
    mhhhhhhssgvdlgtenlyfqsmklqeqhyheaasflssrlpgdaktaiilgsglgelae
    kienktvipyneiphfaqatavghkgniiggilggtpvvamqgrfhyyegysmdqvtfpi
    rvmkllgienlfvsnaaggintsfkvgdlmiicdhinnlpnpligpnmdmfgvrfpdmtr
    aydrefiakakgiaqelnipvkegvyvgltgpsyetpaeykfwgqvggdaigmstvpevi
    varhtgirvfgmsvitnegyhfaddfvndeqdviraanaasekmgaifarliaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ns1A (A:)
    mklqeqhyheaasflssrlpgdaktaiilgsglgelaekienktvipyneiphfaqakgn
    iiggilggtpvvamqgrfhyyegysmdqvtfpirvmkllgienlfvsnaaggintsfkvg
    dlmiicdhinnlpnpligpnmdmfgvrfpdmtraydrefiakakgiaqelnipvkegvyv
    gltgpsyetpaeykfwgqvggdaigmstvpevivarhtgirvfgmsvitnegyhfaddfv
    ndeqdviraanaasekmgaifarliaav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ns1B (B:)
    mhhhhhhssgvdlgtenlyfqsmklqeqhyheaasflssrlpgdaktaiilgsglgelae
    kienktvipyneiphfaqatavghkgniiggilggtpvvamqgrfhyyegysmdqvtfpi
    rvmkllgienlfvsnaaggintsfkvgdlmiicdhinnlpnpligpnmdmfgvrfpdmtr
    aydrefiakakgiaqelnipvkegvyvgltgpsyetpaeykfwgqvggdaigmstvpevi
    varhtgirvfgmsvitnegyhfaddfvndeqdviraanaasekmgaifarliaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ns1B (B:)
    qsmklqeqhyheaasflssrlpgdaktaiilgsglgelaekienktvipyneiphfaqak
    gniiggilggtpvvamqgrfhyyegysmdqvtfpirvmkllgienlfvsnaaggintsfk
    vgdlmiicdhinnlpnpligpnmdmfgvrfpdmtraydrefiakakgiaqelnipvkegv
    yvgltgpsyetpaeykfwgqvggdaigmstvpevivarhtgirvfgmsvitnegyhfadd
    fvndeqdviraanaasekmgaifarliaav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ns1C (C:)
    mhhhhhhssgvdlgtenlyfqsmklqeqhyheaasflssrlpgdaktaiilgsglgelae
    kienktvipyneiphfaqatavghkgniiggilggtpvvamqgrfhyyegysmdqvtfpi
    rvmkllgienlfvsnaaggintsfkvgdlmiicdhinnlpnpligpnmdmfgvrfpdmtr
    aydrefiakakgiaqelnipvkegvyvgltgpsyetpaeykfwgqvggdaigmstvpevi
    varhtgirvfgmsvitnegyhfaddfvndeqdviraanaasekmgaifarliaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ns1C (C:)
    mklqeqhyheaasflssrlpgdaktaiilgsglgelaekienktvipyneiphfaqgnii
    ggilggtpvvamqgrfhyyegysmdqvtfpirvmkllgienlfvsnaaggintsfkvgdl
    miicdhinnlpnpligpnmdmfgvrfpdmtraydrefiakakgiaqelnipvkegvyvgl
    tgpsyetpaeykfwgqvggdaigmstvpevivarhtgirvfgmsvitnegyhfaddfvnd
    eqdviraanaasekmgaifarliaav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ns1D (D:)
    mhhhhhhssgvdlgtenlyfqsmklqeqhyheaasflssrlpgdaktaiilgsglgelae
    kienktvipyneiphfaqatavghkgniiggilggtpvvamqgrfhyyegysmdqvtfpi
    rvmkllgienlfvsnaaggintsfkvgdlmiicdhinnlpnpligpnmdmfgvrfpdmtr
    aydrefiakakgiaqelnipvkegvyvgltgpsyetpaeykfwgqvggdaigmstvpevi
    varhtgirvfgmsvitnegyhfaddfvndeqdviraanaasekmgaifarliaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ns1D (D:)
    fqsmklqeqhyheaasflssrlpgdaktaiilgsglgelaekienktvipyneiphfaqk
    gniiggilggtpvvamqgrfhyyegysmdqvtfpirvmkllgienlfvsnaaggintsfk
    vgdlmiicdhinnlpnpligpnmdmfgvrfpdmtraydrefiakakgiaqelnipvkegv
    yvgltgpsyetpaeykfwgqvggdaigmstvpevivarhtgirvfgmsvitnegyhfadd
    fvndeqdviraanaasekmgaifarliaav