PDB entry 4ns0

View 4ns0 on RCSB PDB site
Description: The C2A domain of Rabphilin 3A in complex with PI(4,5)P2
Class: protein transport
Keywords: C2 domain, Calcium binding, phospholipid binding, RABPHILIN-3A, C2A, SYNAPTIC EXOCYTOSIS METAL-BINDING, PROTEIN TRANSPORT, C-2 domain fold, EXOPHILIN-1
Deposited on 2013-11-27, released 2013-12-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rabphilin-3a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rph3a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4ns0a_
  • Heterogens: PIO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ns0A (A:)
    dqattlgalefsllydqdnsnlqctiirakglkpmdsngladpyvklhllpgasksnklr
    tktlrntrnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetrfslkklkan
    qrknfniclervi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ns0A (A:)
    tlgalefsllydqdnsnlqctiirakglkpmdsngladpyvklhllpgasksnklrtktl
    rntrnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetrfslkklkanqrkn
    fniclerv