PDB entry 4nrv

View 4nrv on RCSB PDB site
Description: Crystal Structure of non-edited human NEIL1
Class: hydrolase, lyase
Keywords: zincless finger domain, DNA glycosylase, Helix two-turns helix motif, HYDROLASE, LYASE
Deposited on 2013-11-27, released 2014-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.183
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endonuclease 8-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Endonuclease VIII (nei) 1, NEIL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96FI4 (0-288)
      • engineered mutation (145)
    Domains in SCOPe 2.07: d4nrva1, d4nrva2, d4nrva3
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nrvA (A:)
    pegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlils
    plpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrfg
    rwdlggkwqpgrgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylrae
    ilyrlkippfekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlgg
    kgygsesgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplaplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nrvA (A:)
    pegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlils
    plpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrfg
    rwdlggkwqpgrgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylrae
    ilyrlkippfekarsvlealqeltlsqkirtklqnpdllelchsvpkevvqlggkgygse
    sgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplap