PDB entry 4nrl

View 4nrl on RCSB PDB site
Description: Structure of hemagglutinin with F95Y mutation of influenza virus B/Lee/40
Class: Viral Protein
Keywords: HA, Viral Protein
Deposited on 2013-11-26, released 2014-03-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.196
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza B virus [TaxId:107412]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03460 (0-End)
      • conflict (37)
      • conflict (75)
      • conflict (89)
      • engineered mutation (94)
      • conflict (146)
      • conflict (166)
    Domains in SCOPe 2.03: d4nrla_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza B virus [TaxId:107412]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03460 (0-End)
      • conflict (53)
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza B virus [TaxId:107412]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03460 (0-End)
      • conflict (37)
      • conflict (75)
      • conflict (89)
      • engineered mutation (94)
      • conflict (146)
      • conflict (166)
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza B virus [TaxId:107412]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03460 (0-End)
      • conflict (53)
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza B virus [TaxId:107412]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03460 (0-End)
      • conflict (37)
      • conflict (75)
      • conflict (89)
      • engineered mutation (94)
      • conflict (146)
      • conflict (166)
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza B virus [TaxId:107412]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03460 (0-End)
      • conflict (53)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4nrlA (A:)
drictgitssnsphvvktatqgevnvtgvipltttptrshfanlkgtqtrgklcpncfnc
tdldvalgrpkcmgnipsakvsilhevkpvtsgcypimhdrtkirqlpnllrgyenirls
tsnvintetapggpykvgtsgscpnvtngngffntmawvipkdnnkiainpvtvevpyic
segedqitvwgfhsddktqmerlygdsnpqkftssangvtthyvsqiggfpnqtedeglk
qsgrivvdymvqkpgktgtivyqrgillpqkvwcasgrskvikgslpligeadclhekyg
glnkskpyytgehakaigncpiwvktplklangtkyrppakllker

    Sequence, based on observed residues (ATOM records): (download) 
    >4nrlA (A:)
drictgitssnsphvvktatqgevnvtgvipltttptrshfanlkgtqtrgklcpncfnc
tdldvalgrpkcmgnipsakvsilhevkpvtsgcypimhdrtkirqlpnllrgyenirls
tsnvintetapggpykvgtsgscpnvtngngffntmawvipkdnnkiainpvtvevpyic
segedqitvwgfhsddktqmerlygdsnpqkftssangvtthyvsqiggfpnqtedeglk
qsgrivvdymvqkpgktgtivyqrgillpqkvwcasgrskvikgslpligeadclhekyg
glnkskpyytgehakaigncpiwvktplklangtkyrppak

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.