PDB entry 4nri

View 4nri on RCSB PDB site
Description: Crystal Structure of a human Mms2/Ubc13 A122G mutant
Class: ligase
Keywords: ubc13, mms2, E2, ubiquitin conjugating enzyme, ligase
Deposited on 2013-11-26, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-31, with a file datestamp of 2014-12-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nria_
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, UBE2N
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61088 (8-155)
      • engineered mutation (127)
    Domains in SCOPe 2.07: d4nrib_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nriA (A:)
    gplgspefgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtn
    yenriyslkvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikv
    vlqelrrlmmskenmklpqppegqtynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nriA (A:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqtynn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nriB (B:)
    gplgspefglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfkl
    elflpeeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsa
    pnpddplgndvaeqwktneaqaietarawtrlyamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nriB (B:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpdgndv
    aeqwktneaqaietarawtrlyamn