PDB entry 4nrb

View 4nrb on RCSB PDB site
Description: Crystal Structure of the bromodomain of human BAZ2B in complex with compound-1 N01197
Class: transcription
Keywords: SGC, Structural Genomics Consortium, TRANSCRIPTION, bromodomain, acetylated lysine binding protein, KIAA1476, WALp4
Deposited on 2013-11-26, released 2013-12-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.181
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4nrba_
  • Heterogens: 2LX, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4nrbA (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs

    Sequence, based on observed residues (ATOM records): (download) 
    >4nrbA (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtf