PDB entry 4nrb
View 4nrb on RCSB PDB site
Description: Crystal Structure of the bromodomain of human BAZ2B in complex with compound-1 N01197
Class: transcription
Keywords: SGC, Structural Genomics Consortium, TRANSCRIPTION, bromodomain, acetylated lysine binding protein, KIAA1476, WALp4
Deposited on
2013-11-26, released
2013-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated
2014-07-02, with a file datestamp of
2014-06-27.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.181
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain adjacent to zinc finger domain protein 2B
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2B, KIAA1476
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4nrba1, d4nrba2 - Heterogens: 2LX, EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4nrbA (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs
Sequence, based on observed residues (ATOM records): (download)
>4nrbA (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtf