PDB entry 4nr6

View 4nr6 on RCSB PDB site
Description: Crystal structure of the bromodomain of human CREBBP in complex with an oxazepin ligand
Class: transcription/inhibitor
Keywords: Structural Genomics Consortium, SGC, chemical tool, small molecule inhibitor, transcription, TRANSCRIPTION-INHIBITOR complex
Deposited on 2013-11-26, released 2013-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CBP, CREBBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4nr6a_
  • Heterogens: 2LN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nr6A (A:)
    smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
    krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nr6A (A:)
    kkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrk
    ldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg