PDB entry 4nr0

View 4nr0 on RCSB PDB site
Description: Crystal structure of the Pseudomonas aeruginosa Enoyl-Acyl Carrier Protein Reductase (FabI) in complex with NAD+ and triclosan
Class: oxidoreductase
Keywords: Rossmann fold motif, reductase, cytosol, OXIDOREDUCTASE
Deposited on 2013-11-26, released 2014-11-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nr0a_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nr0b_
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nr0c_
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nr0d_
  • Heterogens: NAD, TCL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nr0A (A:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nr0A (A:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdlas
    gisgeilyvdggfnttamg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nr0B (B:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nr0B (B:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdlas
    gisgeilyvdggfnttamg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nr0C (C:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nr0C (C:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdlas
    gisgeilyvdggfnttamgpl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nr0D (D:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nr0D (D:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdlas
    gisgeilyvdggfnttamgpl