PDB entry 4nqz

View 4nqz on RCSB PDB site
Description: Crystal Structure of the Pseudomonas aeruginosa Enoyl-Acyl Carrier Protein Reductase (FabI) in apo form
Class: oxidoreductase
Keywords: Rossmann fold motif, reductase, cytosol, OXIDOREDUCTASE
Deposited on 2013-11-26, released 2014-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqza_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzb_
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzc_
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzd_
  • Chain 'E':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqze_
  • Chain 'F':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzf_
  • Chain 'G':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzg_
  • Chain 'H':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzh_
  • Chain 'I':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzi_
  • Chain 'J':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzj_
  • Chain 'K':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzk_
  • Chain 'L':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzl_
  • Chain 'M':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzm_
  • Chain 'N':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzn_
  • Chain 'O':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzo_
  • Chain 'P':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: fabI, PA1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nqzp_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nqzA (A:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzA (A:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpirtkmlaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvd
    ggfnttam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nqzB (B:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzB (B:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpilaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdggfn
    tta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nqzC (C:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzC (C:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpimlaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdggf
    nttam
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nqzD (D:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzD (D:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpikmlaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdgg
    fnttam
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4nqzE (E:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzE (E:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpilaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdggfn
    ttam
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4nqzF (F:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzF (F:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpirlaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdggf
    nttam
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4nqzG (G:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzG (G:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpilaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdggfn
    ttam
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4nqzH (H:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzH (H:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpirrkmlaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvd
    ggfnttam
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4nqzI (I:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzI (I:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpilaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdggfn
    ttam
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4nqzJ (J:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzJ (J:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpimlaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdggf
    nttam
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4nqzK (K:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzK (K:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpirmlaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdgg
    fnttam
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4nqzL (L:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzL (L:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpirlaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdggf
    ntta
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4nqzM (M:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzM (M:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpirmlaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdgg
    fntta
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4nqzN (N:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzN (N:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpirmlaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdgg
    fntt
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4nqzO (O:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzO (O:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpirrkmlaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvd
    ggfntta
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4nqzP (P:)
    mgfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpe
    lcfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahd
    isaysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagsl
    gaegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdla
    sgisgeilyvdggfnttamgpldddlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nqzP (P:)
    gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
    cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
    saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
    aegtrvnavsagpirkmlaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdg
    gfnttamg